PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.G00093.3.p
Common NameMIMGU_mgv1a001025mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family CAMTA
Protein Properties Length: 869aa    MW: 98305.6 Da    PI: 7.2526
Description CAMTA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.G00093.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CG-1133.57.3e-4228436118
              CG-1  36 sgsliLynrkkvryfrkDGyswkkkkdgktvrEdhekLKvggvevlycyYahseenptfqrrcywlLeeelekivlvhylevk 118
                       +g+++L++rk++r+frkDG++wkkkkdgktv+E+he+LKvg+ e +++yYah+e+ ptf rrcywlL+++le+ivlvhy+e++
  Migut.G00093.3.p   2 CGTIVLFDRKMLRNFRKDGHNWKKKKDGKTVKEAHEHLKVGNEERIHVYYAHGEDSPTFVRRCYWLLDKSLEHIVLVHYRETQ 84 
                       699*****************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM010761.8E-40184IPR005559CG-1 DNA-binding domain
PROSITE profilePS5143761.391189IPR005559CG-1 DNA-binding domain
PfamPF038592.6E-35382IPR005559CG-1 DNA-binding domain
SuperFamilySSF812968.4E-10319404IPR014756Immunoglobulin E-set
SuperFamilySSF484031.2E-17487616IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.201.3E-17499617IPR020683Ankyrin repeat-containing domain
CDDcd002043.13E-16499614No hitNo description
PfamPF127963.0E-7501584IPR020683Ankyrin repeat-containing domain
PROSITE profilePS5029716.494510587IPR020683Ankyrin repeat-containing domain
PROSITE profilePS5008811.968555587IPR002110Ankyrin repeat
SMARTSM002481.8E-6555584IPR002110Ankyrin repeat
SuperFamilySSF525408.23E-7683769IPR027417P-loop containing nucleoside triphosphate hydrolase
SMARTSM0001523718740IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500967.071719748IPR000048IQ motif, EF-hand binding site
SMARTSM000151.9E-4741763IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500969.798742766IPR000048IQ motif, EF-hand binding site
PfamPF006121.3E-4743763IPR000048IQ motif, EF-hand binding site
SMARTSM0001513822844IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500968.297824852IPR000048IQ motif, EF-hand binding site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 869 aa     Download sequence    Send to blast
MCGTIVLFDR KMLRNFRKDG HNWKKKKDGK TVKEAHEHLK VGNEERIHVY YAHGEDSPTF  60
VRRCYWLLDK SLEHIVLVHY RETQELQGSP ATPVNSNSSP AVSDPSASWP LSEESDSAGH  120
QVNYGSSMSP LERNDSMTIK NHQQTLHEIN TLEWDELVVP DDLDKLNSPE EVQFAGFELA  180
NQYQTSNNRT NDDAVSTSKV TPQSSGNSFY EQVGKSNSMN HKNSNNLSYQ TVGHEMNVHS  240
ETMISGLGTL SGASSIYNLA KDGLQAQDSF GRWATYDIDN SLESLVDQEL ESSVLNGHQS  300
FSYQKIDNHQ PSPPGQIFNI TDISPASALS TEETKILVIG FFSEGQLPRT DSKLYLACGD  360
SIFPLEIVQG GVFRCLIPPQ TPGSVNLYMT FDGHKPISQV LTFEVRAPVQ PNRMVSFENK  420
TDWKEFQLQL RLAHLLFSSA KGLSIYNTKI SQTALKEAKA FAQKTSHISN GWVFLSKMIE  480
ERQMSFPQAK DQLFELTLHN RLLEWLLEKV AAGSKISERD EQGQGVIHLC AILGYTWAVY  540
PFSWSGLSLD YRDKHGWTAL HWAAYYGREK MVATLLSAGA KPNLVTDPTS QNPGGCNAAD  600
LASTNGYDGL AAYLAEKALV EQFKEMTVAG NVSGSLQTSS NEPINPENFT EEELYLKDTL  660
IAYRTAADAA ARINAAFREH SFKIRKQAVE SSNPEIEARN IVAAMKIQHA FRKYETHKKL  720
AAAARIQYRF RTWKIRKDFL NMRRQAIKIQ AHFRGFQVRR HYRQIVWSVG VLEKAVLRWR  780
LKRKGFRGLQ VQPETAVVDP NQDGEVVEEA FFRASRKQAE DRVERSVVRV QAMFRSKQAQ  840
EEYRRMKLEH SKAKLEYDEL LHPDDEMG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012827766.10.0PREDICTED: calmodulin-binding transcription activator 5-like isoform X2
SwissprotO234630.0CMTA5_ARATH; Calmodulin-binding transcription activator 5
TrEMBLA0A022RYH30.0A0A022RYH3_ERYGU; Uncharacterized protein
STRINGVIT_05s0077g01240.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16150.10.0calmodulin binding;transcription regulators